HPA021251

BAAT antibody from MilliporeSigma / Merck KGaA
BAT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021251
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA021251, RRID:AB_1845247
Product name
Anti-BAAT antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA021251
Antibody type
Polyclonal
Antigen
Bile acid-CoA:amino acid N-acyltransferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LFPIEEAQGQFLFIVGEGDKTINSKAHAEQAIGQL
KRHGKNNWTLLSYPGAGHLIEPPYSPLCCASTTHD
LRLHWGGEVIPH
Storage
-20C
Provider Type Product Number
- No reagents -