Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503594 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Peptidyl Arginine Deiminase, Type IV (PADI4) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PADI4 antibody: synthetic peptide directed towards the middle region of human PADI4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
TGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGD
SCYPS NDSRQMHQAL- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Genetic polymorphisms in PTPN22, PADI-4, and CTLA-4 and risk for rheumatoid arthritis in two longitudinal cohort studies: evidence of gene-environment interactions with heavy cigarette smoking.
Costenbader KH, Chang SC, De Vivo I, Plenge R, Karlson EW
Arthritis research & therapy 2008;10(3):R52
Arthritis research & therapy 2008;10(3):R52
No comments: Submit comment
No validations: Submit validation data