HPA017007

PADI4 antibody from Sigma-Aldrich
PAD, PADI5, PDI4, PDI5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017007
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017007, RRID:AB_1854921
Product name
Anti-PADI4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017007
Antibody type
Polyclonal
Antigen
Protein-arginine deiminase type-4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CEDDEVLDSEDLQDMSLMTLSTKTPKDFFTNHTLV
LHVARSEMDKVRVFQATRGKLSSKCSVVLGPKWPS
HYLMVPGGKHNMDFYVEALAFPDTDFPGLITLTIS
LLD
Storage
-20C
Provider Type Product Number
- No reagents -