HPA008252

IL24 antibody from Sigma-Aldrich
C49A, FISP, IL-24, IL10B, mda-7, Mob-5, ST16
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008252
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008252, RRID:AB_1079136
Product name
Anti-IL24 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008252
Antibody type
Polyclonal
Antigen
Interleukin-24 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSD
AESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSF
STLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLL
FRRAFKQLDV
Storage
-20C
Provider Type Product Number
- No reagents -