HPA019656

KRT76 antibody from Atlas Antibodies
HUMCYT2A, KRT2B, KRT2P
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019656
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019656, RRID:AB_1852241
Product name
Anti-KRT76
Provider product page
Atlas Antibodies - HPA019656
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SGSGYGGVSSGSTGGRGSSGSYQSSSSGSRLGGAG
SISVSHSGMGSSSGSIQTSGGSGYKSGGGGSTSIR
FSQTTSSSQHSSTK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -