HPA019656

KRT76 antibody from Sigma-Aldrich
HUMCYT2A, KRT2B, KRT2P
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019656
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019656, RRID:AB_1852241
Product name
Anti-KRT76 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019656
Antibody type
Polyclonal
Antigen
Keratin, type II cytoskeletal 2 oral recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SGSGYGGVSSGSTGGRGSSGSYQSSSSGSRLGGAG
SISVSHSGMGSSSGSIQTSGGSGYKSGGGGSTSIR
FSQTTSSSQHSSTK
Storage
-20C
Provider Type Product Number
- No reagents -