H00338339-B01P

CLEC4D antibody from Abnova Corporation
CD368, CLECSF8, Dectin-3, MCL, Mpcl

Antibody data

Product number
H00338339-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00338339-B01P, RRID:AB_1573069
Product name
CLEC4D purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00338339-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CLEC4D protein.
Antigen sequence
MGLEKPQSKLEGGMHPQLIPSVIAVVFILLLSVCF
IASCLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEK
SELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTW
AESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLS
YFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPD
NSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIP
GTTLN
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -