HPA004906

CLEC4D antibody from Atlas Antibodies
CD368, CLECSF8, Dectin-3, MCL, Mpcl
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004906
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004906, RRID:AB_1078535
Product name
Anti-CLEC4D
Provider product page
Atlas Antibodies - HPA004906
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAF
QSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEA
EQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTP
FNPRR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -