HPA024505

FAM83H antibody from Atlas Antibodies
FLJ46072
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024505
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024505, RRID:AB_1848417
Product name
Anti-FAM83H
Provider product page
Atlas Antibodies - HPA024505
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SDKDKCSAIFRSDSLGTQGRLSRTLPASAEERDRL
LRRMESMRKEKRVYSRFEVFCKKEEASSPGAGEGP
AEEGTRDSKVGKFVPKILGTF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -