HPA024604

FAM83H antibody from Sigma-Aldrich
FLJ46072
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024604
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024604, RRID:AB_1848418
Product name
Anti-FAM83H antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024604
Antibody type
Polyclonal
Antigen
Protein FAM83H recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VVSQAWREEVAAPGAVGGERRSLESCLLDLRDSFA
QQLHQEAERQPGAASLTAAQLLDTLGRSGSDRLPS
RFLSAQSHSTSPQGLDSPLPLEGS
Storage
-20C
Provider Type Product Number
- No reagents -