HPA018310

MYRF antibody from Sigma-Aldrich
C11orf9, MRF, Ndt80, pqn-47
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018310
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018310, RRID:AB_1845534
Product name
Anti-C11orf9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018310
Antibody type
Polyclonal
Antigen
Uncharacterized protein C11orf9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SDVLWQRAQVPDTVFHHGRVGINTDRPDEALVVHG
NVKVMGSLMHPSDLRAKEHVQEVDTTEQLKRISRM
RLVHYRYKPEFAASAGIEATAPET
Storage
-20C
Provider Type Product Number
- No reagents -