H00006737-D01

TRIM21 antibody from Abnova Corporation
RNF81, RO52, SSA1

Antibody data

Product number
H00006737-D01
Provider
Abnova Corporation
Product name
TRIM21 MaxPab rabbit polyclonal antibody (D01)
Provider product page
Abnova Corporation - H00006737-D01
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human TRIM21 protein.
Antigen sequence
MASAARLTMMWEEVTCPICLDPFVEPVSIECGHSF
CQECISQVGKGGGSVCPVCRQRFLLKNLRPNRQLA
NMVNNLKEISQEAREGTQGERCAVHGERLHLFCEK
DGKALCWVCAQSRKHRDHAMVPLEEAAQEYQEKLQ
VALGELRRKQELAEKLEVEIAIKRADWKKTVETQK
SRIHAEFVQQKNFLVEEEQRQLQELEKDEREQLRI
LGEKEAKLAQQSQALQELISELDRRCHSSALELLQ
EVIIVLERSESWNLKDLDITSPELRSVCHVPGLKK
MLRTCAVHITLDPDTANPWLILSEDRRQVRLGDTQ
QSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTG
KEAWDLGVCRDSVRRKGHFLLSSKSGFWTIWLWNK
QKYEAGTYPQTPLHLQVPPCQVGIFLDYEAGMVSF
YNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGK
NTAPLTLCPLNIGSQGSTDY
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -