Antibody data

Product number
H00006737-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006737-M01, RRID:AB_1205118
Product name
TRIM21 monoclonal antibody (M01), clone 2C9
Provider product page
Abnova Corporation - H00006737-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant TRIM21.
Antigen sequence
MASAARLTMMWEEVTCPICLDPFVEPVSIECGHSF
CQECISQVGKGGGSVCPVCRQRFLLKNLRPNRQLA
NMVNNLKEISQEAREGTQGERCAVHGERLHLFCEK
DGKALCWVCAQSRKHRDHAMVPLEEAAQEYQEKLQ
VALGELRRKQELAEKLEVEIAIKRADWKKTVETQK
SRIHAEFVQQKNFLVEEEQRQLQELEKDEREQLRI
LGEKEAKLAQQSQALQELISELDRRCHSSALELLQ
EVIIVLERSESWNLKDLDITSPELRSVCHVPGLKK
MLRTCAVHITLDPDTANPWLILSEDRRQVRLGDTQ
QSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTG
KEAWDLGVCRDSVRRKGHFLLSSKSGFWTIWLWNK
QKYEAGTYPQTPLHLQVPPCQVGIFLDYEAGMVSF
YNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGK
NTAPLTLCPLNIGSQGSTDY
Isotype
IgG
Antibody clone number
2C9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -