Explore
Validate
LearnAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009578-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009578-A01, RRID:AB_462606
- Product name
- CDC42BPB polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant CDC42BPB.
- Antigen sequence
SKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPP
SQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEP
SVTVPLRSMSDPDQDFDKEPDSDSTKHSTP- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A novel small-molecule MRCK inhibitor blocks cancer cell invasion.
Co-crystal structures of inhibitors with MRCKβ, a key regulator of tumor cell invasion.
Visual screening and analysis for kinase-regulated membrane trafficking pathways that are involved in extensive beta-amyloid secretion.
Unbekandt M, Croft DR, Crighton D, Mezna M, McArthur D, McConnell P, Schüttelkopf AW, Belshaw S, Pannifer A, Sime M, Bower J, Drysdale M, Olson MF
Cell communication and signaling : CCS 2014 Oct 5;12:54
Cell communication and signaling : CCS 2014 Oct 5;12:54
Co-crystal structures of inhibitors with MRCKβ, a key regulator of tumor cell invasion.
Heikkila T, Wheatley E, Crighton D, Schroder E, Boakes A, Kaye SJ, Mezna M, Pang L, Rushbrooke M, Turnbull A, Olson MF
PloS one 2011;6(9):e24825
PloS one 2011;6(9):e24825
Visual screening and analysis for kinase-regulated membrane trafficking pathways that are involved in extensive beta-amyloid secretion.
Adachi A, Kano F, Saido TC, Murata M
Genes to cells : devoted to molecular & cellular mechanisms 2009 Mar;14(3):355-69
Genes to cells : devoted to molecular & cellular mechanisms 2009 Mar;14(3):355-69
No comments: Submit comment
No validations: Submit validation data