Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009578-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009578-M03, RRID:AB_913378
- Product name
- CDC42BPB monoclonal antibody (M03), clone 2F4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CDC42BPB.
- Antigen sequence
SKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPP
SQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEP
SVTVPLRSMSDPDQDFDKEPDSDSTKHSTP- Isotype
- IgG
- Antibody clone number
- 2F4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CDC42BPB monoclonal antibody (M03), clone 2F4. Western Blot analysis of CDC42BPB expression in PC-12(Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CDC42BPB is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to CDC42BPB on A-431 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to CDC42BPB on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol