HPA022821

CDC42BPB antibody from Sigma-Aldrich
KIAA1124, MRCKB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022821
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022821, RRID:AB_1846376
Product name
Anti-CDC42BPB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022821
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase MRCK beta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KSKFSGAVLNVPDTSDNSKKQMLRTRSKRRFVFKV
PEEERLQQRREMLRDPELRSKMISNPTNFNHVAHM
GPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQ
PPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDF
DKEPDSDST
Storage
-20C
Provider Type Product Number
- No reagents -