HPA003639

SETD3 antibody from Sigma-Aldrich
C14orf154, FLJ23027
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003639
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003639, RRID:AB_1079931
Product name
Anti-SETD3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003639
Antibody type
Polyclonal
Antigen
SET domain-containing protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SGTGATATVSPKEILNLTSELLQKCSSPAPGPGKE
WEEYVQIRTLVEKIRKKQKGLSVTFDGKREDYFPD
LMKWASENGASVEGFEMVNFKEEGFGLRATRDIKA
EELFLWVPRKLLMTVE
Storage
-20C
Provider Type Product Number
- No reagents -