H00009976-B01P

CLEC2B antibody from Abnova Corporation
AICL, CLECSF2, HP10085

Antibody data

Product number
H00009976-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009976-B01P, RRID:AB_1138083
Product name
CLEC2B purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00009976-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CLEC2B protein.
Antigen sequence
MMTKHKKCFIIVGVLITTNIITLIVKLTRDSQSLC
PYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHADL
TIIDNIEETNFLRRYKCSSDHWIGLKMAKNRTGQW
VDGATFTKSFGMRGSEGCAYLSDDGAATARCYTER
KWICKKRIH
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -