HPA008194

CLEC2B antibody from Sigma-Aldrich
AICL, CLECSF2, HP10085
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008194
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008194, RRID:AB_1078533
Product name
Anti-CLEC2B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008194
Antibody type
Polyclonal
Antigen
C-type lectin domain family 2 member B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LCPYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHA
DLTIIDNIEEMNFLRRYKCSSDHWIGLKMAKNRTG
QWVDGATFTKSFGMRGSEGCAYLSDDGAATARCYT
ERKWICRKR
Storage
-20C
Provider Type Product Number
- No reagents -