H00056916-B01P

SMARCAD1 antibody from Abnova Corporation
DKFZP762K2015, ETL1, KIAA1122

Antibody data

Product number
H00056916-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00056916-B01P, RRID:AB_1580781
Product name
SMARCAD1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00056916-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SMARCAD1 protein.
Antigen sequence
MNLFNLDRFRFEKRNKIEEAPEATPQPSQPGPSSP
ISLSAEEENAEGEVSRANTPDSDITEKTEDSSVPE
TPDNERKASISYFKNQRGIQYIDLSSDSEDVVSPN
CSNTVQEKTFNKDTVIIVSEPSEDEESQGLPTMAR
RNDDISELEDLSELEDLKDAKLQTLKELFPQRSDN
DLLKLIESTSTMDGAIAAALLMFGDAGGGPRKRKL
SSSSEPYEEDEFNDDQSIKKTRLDHGEESNESAES
SNNWEKQESIVLKLQKEFPNFDKQELREVLKEHEW
MYTEALESLKVFAEDQDMQYASQSEVPNGKEVSSR
SQNYPKNATKTKLKQKFSMKAQNGFNKKRKKNVFN
QKRVVEDSEYDSGSDVGSSLDEDYSSGEEVMEDGY
KGKILHFLQDASIGELTLIPQCSQKKAQKITELRP
FNSWEALFTKMSKTNGLSEDLIWHCKTLIQERDVV
IRLMNKCEDISNKLTKQVTMLTGNGGGWNIEQPSI
LNQSLSLKPYQKVGLNWLALVHKHGLNGILADEMG
LGKTIQAIAFLAYLYQEGNNGPHLIVVPASTIDNW
LREVNLWCPTLKVLCYYGSQEERKQIRFNIHSRYE
DYNVIVTTYNCAISSSDDRSLFRRLKLNYAIFDEG
HMLKNMGSIRYQHLMTINANNRLLLTGTPVQNNLL
ELMSLLNFVMPHMFSSSTSEIRRMFSSKTKSADEQ
SIYEKERIAHAKQIIKPFILRRVKEEVLKQLPPKK
DRIELCAMSEKQEQLYLGLFNRLKKSINNLVTEKN
TEMCNVMMQLRKMANHPLLHRQYYTAEKLKEMSQL
MLKEPTHCEANPDLIFEDMEVMTDFELHVLCKQYR
HINNFQLDMDLILDSGKFRVLGCILSELKQKGDRV
VLFSQFTMMLDILEVLLKHHQHRYLRLDGKTQISE
RIHLIDEFNTDMDIFVFLLSTKAGGLGINLTSANV
VILHDIDCNPYNDKQAEDRCHRVGQTKEALVIKLI
SQGTIEESMLKINQQKLKLEQDMTTVDEGDEGSMP
ADIATLLKTSMGL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -