PAB15737

SMARCAD1 antibody from Abnova Corporation
DKFZP762K2015, ETL1, KIAA1122
No application information provided.

Antibody data

Product number
PAB15737
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB15737, RRID:AB_10697897
Product name
Smarcad1 polyclonal antibody
Provider product page
Abnova Corporation - PAB15737
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against partial recombinant Smarcad1.
Antigen sequence
DSGKFRALGCILSELKQKGDRVVLFSQFTMMLDIL
EVLLKHHQHRYLRLDGKTQISERIHLIDEFNTDMD
IFVFLLSTKAGGLGINLTSANVVILHDIDCNPYND
KQAEDRCHRVGQTKEVLVIKLISQGTIEESMLKIN
QQKLKLEQDMTTVDEADEGSMPADIATLLKTSMGL
Storage
Store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -