HPA016737

SMARCAD1 antibody from Sigma-Aldrich
DKFZP762K2015, ETL1, KIAA1122
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016737
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016737, RRID:AB_1857271
Product name
Anti-SMARCAD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016737
Antibody type
Polyclonal
Antigen
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HGEESNESAESSSNWEKQESIVLKLQKEFPNFDKQ
ELREVLKEHEWMYTEALESLKVFAEDQDMQYVSQS
EVPNGKEVSSRSQNYPKNATKTKLKQKFSMKAQNG
FNKK
Storage
-20C
Provider Type Product Number
- No reagents -