HPA016737

SMARCAD1 antibody from Atlas Antibodies
DKFZP762K2015, ETL1, KIAA1122
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA016737
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016737, RRID:AB_1235684
Product name
Anti-SMARCAD1
Provider product page
Atlas Antibodies - HPA016737
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HGEESNESAESSSNWEKQESIVLKLQKEFPNFDKQ
ELREVLKEHEWMYTEALESLKVFAEDQDMQYVSQS
EVPNGKEVSSRSQNYPKNATKTKLKQKFSMKAQNG
FNKK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -