HPA016737

SMARCAD1 antibody from Atlas Antibodies
DKFZP762K2015, ETL1, KIAA1122
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA016737
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016737, RRID:AB_1857271
Product name
Anti-SMARCAD1
Provider product page
Atlas Antibodies - HPA016737
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HGEESNESAESSSNWEKQESIVLKLQKEFPNFDKQ
ELREVLKEHEWMYTEALESLKVFAEDQDMQYVSQS
EVPNGKEVSSRSQNYPKNATKTKLKQKFSMKAQNG
FNKK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -