HPA007842

antibody from Atlas Antibodies

Targeting: CLEC4A CD367, CLECSF6, DCIR, DDB27

Antibody data

Submit

Validation data

Product number: HPA007842 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA007842, RRID:AB_1078534
Product name: Anti-CLEC4A
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KNWKSFSSNCYFISTESASWQDSEKDCARMEAHLL VINTQEEQDFIFQNLQEESAYFVGLSDPEGQRHWQ WVDQTPYNESSTFWHPREPSDPNERCVVLNFRKSP KRWGWNDVNCLGPQRSVCEMMKIHL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CLEC4A protein structure - HPA007842 shown in red.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bone marrow shows membranous positivity in hematopoietic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymphoid tissues shows moderate membranous positivity in lymphoid cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human gastrointestinal shows moderate to strong membranous positivity in lymphoid cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung shows weak to moderate positivity in macrophages.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Sample type: HUMAN