HPA007842

CLEC4A antibody from Sigma-Aldrich
CD367, CLECSF6, DCIR, DDB27
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007842
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007842, RRID:AB_1078534
Product name
Anti-CLEC4A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007842
Antibody type
Polyclonal
Antigen
C-type lectin domain family 4 member A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KNWKSFSSNCYFISTESASWQDSEKDCARMEAHLL
VINTQEEQDFIFQNLQEESAYFVGLSDPEGQRHWQ
WVDQTPYNESSTFWHPREPSDPNERCVVLNFRKSP
KRWGWNDVNCLGPQRSVCEMMKIHL
Storage
-20C
Provider Type Product Number
- No reagents -