HPA027176

ACTL8 antibody from Sigma-Aldrich
CT57
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027176
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027176, RRID:AB_1844553
Product name
Anti-ACTL8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027176
Antibody type
Polyclonal
Antigen
Actin-like protein 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNY
LPCKENPGPSYARRRVSLGIDICHPDTFSYPIERG
RILNWEGVQYLWSFVLENHRREQ
Storage
-20C
Provider Type Product Number
- No reagents -