SAB1401861

ACTL8 antibody from Sigma-Aldrich
CT57
No application information provided.

Antibody data

Product number
SAB1401861
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1401861, RRID:AB_10607677
Product name
Anti-ACTL8 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1401861
Antibody type
Polyclonal
Antigen
ACTL8 (NP_110439.1, 1 a.a. ~ 366 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MASRTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNY
LPCKENPGPSYARRRVSLGIDICHPDTFSYPIERG
RILNWEGVQYLWSFVLENHRREQEVPPVIITETPL
REPADRKKMLEILFELLHVPSVLLADQLQMSLYAS
GLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEF
AGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMN
KCYVPQNLGEALDFRERQQSALDESNTYQLPDGSR
VELTPMQRVA
Storage
-20C
Provider Type Product Number
- No reagents -