Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA006539 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA006539, RRID:AB_1078984
- Product name
- Anti-SLC2A3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEM
NSIEPAKETTT- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references AMPK modulates Hippo pathway activity to regulate energy homeostasis.
Wang W, Xiao ZD, Li X, Aziz KE, Gan B, Johnson RL, Chen J
Nature cell biology 2015 Apr;17(4):490-9
Nature cell biology 2015 Apr;17(4):490-9
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line CACO-2 shows localization to plasma membrane.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong membranous positivity in cells in seminiferous ducts.
- Sample type
- HUMAN