HPA006539

SLC2A3 antibody from Sigma-Aldrich
GLUT3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006539
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006539, RRID:AB_1078984
Product name
Anti-SLC2A3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006539
Antibody type
Polyclonal
Antigen
Solute carrier family 2, facilitated glucose transporter member 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEM
NSIEPAKETTT
Storage
-20C
Provider Type Product Number
- No reagents -