Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005307-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005307-M01, RRID:AB_464314
- Product name
- PITX1 monoclonal antibody (M01), clone 5G4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PITX1.
- Antigen sequence
MPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSP
GACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSS
FGYGGLQGPASGLNACQYN- Isotype
- IgG
- Antibody clone number
- 5G4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The c-Abl tyrosine kinase stabilizes Pitx1 in the apoptotic response to DNA damage.
Transcriptional activation of p53 by Pitx1.
Yamaguchi T, Miki Y, Yoshida K
Apoptosis : an international journal on programmed cell death 2010 Aug;15(8):927-35
Apoptosis : an international journal on programmed cell death 2010 Aug;15(8):927-35
Transcriptional activation of p53 by Pitx1.
Liu DX, Lobie PE
Cell death and differentiation 2007 Nov;14(11):1893-907
Cell death and differentiation 2007 Nov;14(11):1893-907
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PITX1 monoclonal antibody (M01), clone 5G4 Western Blot analysis of PITX1 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PITX1 expression in transfected 293T cell line by PITX1 monoclonal antibody (M01), clone 5G4.Lane 1: PITX1 transfected lysate(34.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PITX1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of PITX1 transfected lysate using anti-PITX1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PITX1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol