Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ARP30947_P050 - Provider product page

- Provider
- Aviva Systems Biology
- Proper citation
- Aviva Systems Biology Cat#ARP30947_P050, RRID:AB_10875549
- Product name
- Pax7 antibody - middle region (ARP30947_P050)
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide
- Description
- This is a rabbit polyclonal antibody against Pax7. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
- Reactivity
- Human, Rat
- Host
- Rabbit
- Antigen sequence
SDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFE
RTHYPDIYTREELAQ- Vial size
- 50 µg
- Concentration
- 1 mg/ml
- Handling
- Add 50 µl of distilled water. Final anti-Pax7 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Submitted references Laminin-111 improves muscle repair in a mouse model of merosin-deficient congenital muscular dystrophy.
Early regulative ability of the neuroepithelium to form cardiac neural crest.
Van Ry PM, Minogue P, Hodges BL, Burkin DJ
Human molecular genetics 2014 Jan 15;23(2):383-96
Human molecular genetics 2014 Jan 15;23(2):383-96
Early regulative ability of the neuroepithelium to form cardiac neural crest.
Ezin AM, Sechrist JW, Zah A, Bronner M, Fraser SE
Developmental biology 2011 Jan 15;349(2):238-49
Developmental biology 2011 Jan 15;349(2):238-49
No comments: Submit comment
Supportive validation
- Submitted by
- Aviva Systems Biology (provider)
- Main image

- Experimental details
- WB Suggested Anti-Pax7Antibody Titration: 0.2-1µg/ml. ELISA Titer: 1:312500Positive Control: Rat Muscle
Supportive validation
- Submitted by
- Aviva Systems Biology (provider)
- Main image

- Experimental details
- Sample Type: C2C12