HPA004915

MTMR7 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004915
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004915, RRID:AB_1854190
Product name
Anti-MTMR7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004915
Antibody type
Polyclonal
Antigen
Myotubularin-related protein 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AHLWKNRADYLNPLFRADHSQTQGTLHLPTTPCNF
MYKFWSGMYNRFEKGMQPRQSVTDYLMAVKEETQQ
LEEELEAL
Storage
-20C
Provider Type Product Number
- No reagents -