HPA010828

CST8 antibody from Sigma-Aldrich
CRES, CTES5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010828
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010828, RRID:AB_1847413
Product name
Anti-CST8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010828
Antibody type
Polyclonal
Antigen
Cystatin-8 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLRKLKPVNASNANVKQCLWFAMQEYNKESEDKYV
FLVVKTLQAQLQVTNLLEYLIDVEIARSDCRKPLS
TNEICAIQENSKLKRKLSCSFLVGALPWNGEFTVM
E
Storage
-20C
Provider Type Product Number
- No reagents -