Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1108526 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Olfactory Receptor, Family 13, Subfamily C, Member 9 (OR13C9) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-OR13C9 antibody: synthetic peptide directed towards the middle region of human OR13C9.
- Description
- Purified on peptide immunoaffinity column
- Reactivity
- Human, Rat, Canine
- Host
- Rabbit
- Antigen sequence
IFYGTILFMYMKPKSKETLNSDDLDATDKIISMFY
GVMTPMMNPLIYSLR- Epitope
- Middle Region
- Vial size
- 50 μg
- Storage
- Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references The human olfactory receptor gene family.
Malnic B, Godfrey PA, Buck LB
Proceedings of the National Academy of Sciences of the United States of America 2004 Feb 24;101(8):2584-9
Proceedings of the National Academy of Sciences of the United States of America 2004 Feb 24;101(8):2584-9
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human HepG2; WB Suggested Anti-OR13C9 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HepG2 cell lysate; OR13C9 antibody - middle region (AP42068PU-N) in Human HepG2 cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Kidney; Rabbit Anti-OR13C9 Antibody. Paraffin Embedded Tissue: Human Kidney. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X; OR13C9 antibody - middle region (AP42068PU-N) in Human Kidney cells using Immunohistochemistry
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Brain; Rabbit Anti-OR13C9 Antibody. Paraffin Embedded Tissue: Human Brain. Cellular Data: Neural Cells. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X; OR13C9 antibody - middle region (AP42068PU-N) in Human Brain cells using Immunohistochemistry