H00054512-M02

EXOSC4 antibody from Abnova Corporation
FLJ20591, hRrp41p, p12A, RRP41, RRP41A, Rrp41p, SKI6, Ski6p

Antibody data

Product number
H00054512-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00054512-M02, RRID:AB_1237698
Product name
EXOSC4 monoclonal antibody (M02), clone 4F9
Provider product page
Abnova Corporation - H00054512-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant EXOSC4.
Antigen sequence
MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQA
DGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRA
LVNCQYSSATFSTGERKRRPHGDRKSCEMG
Isotype
IgG
Antibody clone number
4F9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -