ABIN184186
antibody from antibodies-online
Targeting: CXCL14
BMAC, bolekine, BRAK, Kec, KS1, MIP-2g, NJAC, SCYB14
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184186 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Chemokine (C-X-C Motif) Ligand 14 (CXCL14) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CXCL14 antibody: synthetic peptide directed towards the middle region of human CXCL14
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
HCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFI
KWYNA WNEKRRVYEE- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A
Genome research 2003 Oct;13(10):2265-70
Genome research 2003 Oct;13(10):2265-70
No comments: Submit comment
No validations: Submit validation data