ABIN786554
antibody from antibodies-online
Targeting: CXCL14
BMAC, bolekine, BRAK, Kec, KS1, MIP-2g, NJAC, SCYB14
Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN786554 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Chemokine (C-X-C Motif) Ligand 14 (CXCL14) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CXCL14 antibody: synthetic peptide directed towards the middle region of human CXCL14
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRF
IKWYN AWNEKRRVYE- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Genomic and metabolic responses to methionine-restricted and methionine-restricted, cysteine-supplemented diets in Fischer 344 rat inguinal adipose tissue, liver and quadriceps muscle.
Codelivery of the chemokine CCL3 by an adenovirus-based vaccine improves protection from retrovirus infection.
CXCL14 enhances insulin-dependent glucose uptake in adipocytes and is related to high-fat diet-induced obesity.
Perrone CE, Mattocks DA, Plummer JD, Chittur SV, Mohney R, Vignola K, Orentreich DS, Orentreich N
Journal of nutrigenetics and nutrigenomics 2012;5(3):132-57
Journal of nutrigenetics and nutrigenomics 2012;5(3):132-57
Codelivery of the chemokine CCL3 by an adenovirus-based vaccine improves protection from retrovirus infection.
Lietz R, Bayer W, Ontikatze T, Johrden L, Tenbusch M, Storcksdieck Genannt Bonsmann M, Uberla K, Dittmer U, Wildner O
Journal of virology 2012 Feb;86(3):1706-16
Journal of virology 2012 Feb;86(3):1706-16
CXCL14 enhances insulin-dependent glucose uptake in adipocytes and is related to high-fat diet-induced obesity.
Takahashi M, Takahashi Y, Takahashi K, Zolotaryov FN, Hong KS, Iida K, Okimura Y, Kaji H, Chihara K
Biochemical and biophysical research communications 2007 Dec 28;364(4):1037-42
Biochemical and biophysical research communications 2007 Dec 28;364(4):1037-42
No comments: Submit comment
No validations: Submit validation data