HPA008802

SLC6A8 antibody from MilliporeSigma / Merck KGaA
CRTR, CT1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008802
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-SLC6A8 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA008802
Antibody type
Polyclonal
Antigen
Sodium- and chloride-dependent creatine transporter 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YLVKSFTTTLPWATCGHTWNTPDCVEIFRHEDCAN
ASLANLTCDQLADRRSPVIE
Storage
-20C