HPA008802

SLC6A8 antibody from Sigma-Aldrich
CRTR, CT1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008802
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008802, RRID:AB_1857206
Product name
Anti-SLC6A8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008802
Antibody type
Polyclonal
Antigen
Sodium- and chloride-dependent creatine transporter 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YLVKSFTTTLPWATCGHTWNTPDCVEIFRHEDCAN
ASLANLTCDQLADRRSPVIE
Storage
-20C
Provider Type Product Number
- No reagents -