HPA007150

TRPV4 antibody from Sigma-Aldrich
CMT2C, OTRPC4, TRP12, VR-OAC, VRL-2, VROAC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007150
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007150, RRID:AB_1080393
Product name
Anti-TRPV4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007150
Antibody type
Polyclonal
Antigen
Transient receptor potential cation channel subfamily V member 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EDGSLSPSPADASRPAGPGDGRPNLRMKFQGAFRK
GVPNPIDLLESTLYESSVVPGPKKAPMDSLFDYGT
YRHHSSDNKRWRKKIIEKQPQSPKAPAP
Storage
-20C
Provider Type Product Number
- No reagents -