Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003911-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003911-M01, RRID:AB_509361
- Product name
- LAMA5 monoclonal antibody (M01), clone 2F7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant LAMA5.
- Antigen sequence
MGVSLRDKKVHWVYQLGEAGPAVLSIDEDIGEQFA
AVSLDRTLQFGHMSVTVERQMIQETKGDTVAPGAE
GLLNLRPDDFVFYVGGYPSTFTPPPLLRFP- Isotype
- IgG
- Antibody clone number
- 2F7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Genome-wide Runx2 occupancy in prostate cancer cells suggests a role in regulating secretion.
Melanoma cells produce multiple laminin isoforms and strongly migrate on α5 laminin(s) via several integrin receptors.
Proteomics analysis of nasopharyngeal carcinoma cell secretome using a hollow fiber culture system and mass spectrometry.
Proteomic analysis of platelet alpha-granules using mass spectrometry.
Little GH, Noushmehr H, Baniwal SK, Berman BP, Coetzee GA, Frenkel B
Nucleic acids research 2012 Apr;40(8):3538-47
Nucleic acids research 2012 Apr;40(8):3538-47
Melanoma cells produce multiple laminin isoforms and strongly migrate on α5 laminin(s) via several integrin receptors.
Oikawa Y, Hansson J, Sasaki T, Rousselle P, Domogatskaya A, Rodin S, Tryggvason K, Patarroyo M
Experimental cell research 2011 May 1;317(8):1119-33
Experimental cell research 2011 May 1;317(8):1119-33
Proteomics analysis of nasopharyngeal carcinoma cell secretome using a hollow fiber culture system and mass spectrometry.
Wu HY, Chang YH, Chang YC, Liao PC
Journal of proteome research 2009 Jan;8(1):380-9
Journal of proteome research 2009 Jan;8(1):380-9
Proteomic analysis of platelet alpha-granules using mass spectrometry.
Maynard DM, Heijnen HF, Horne MK, White JG, Gahl WA
Journal of thrombosis and haemostasis : JTH 2007 Sep;5(9):1945-55
Journal of thrombosis and haemostasis : JTH 2007 Sep;5(9):1945-55
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of LAMA5 expression in transfected 293T cell line by LAMA5 monoclonal antibody (M01), clone 2F7.Lane 1: LAMA5 transfected lysate(74 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged LAMA5 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol