Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002166-M07 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002166-M07, RRID:AB_565720
- Product name
- FAAH monoclonal antibody (M07), clone 4H8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FAAH.
- Antigen sequence
DLNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTA
EDEAQMEHYRGYFGDIWDKMLQKGMKKSVGLPVAV
QCVALPWQEELCLRFMREVERLMTPEKQSS- Isotype
- IgG
- Antibody clone number
- 4H8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Dysfunction in fatty acid amide hydrolase is associated with depressive-like behavior in Wistar Kyoto rats.
Selective alterations of the CB1 receptors and the fatty acid amide hydrolase in the ventral striatum of alcoholics and suicides.
RNA interference-mediated knockdown of dynamin 2 reduces endocannabinoid uptake into neuronal dCAD cells.
Vinod KY, Xie S, Psychoyos D, Hungund BL, Cooper TB, Tejani-Butt SM
PloS one 2012;7(5):e36743
PloS one 2012;7(5):e36743
Selective alterations of the CB1 receptors and the fatty acid amide hydrolase in the ventral striatum of alcoholics and suicides.
Vinod KY, Kassir SA, Hungund BL, Cooper TB, Mann JJ, Arango V
Journal of psychiatric research 2010 Jul;44(9):591-7
Journal of psychiatric research 2010 Jul;44(9):591-7
RNA interference-mediated knockdown of dynamin 2 reduces endocannabinoid uptake into neuronal dCAD cells.
McFarland MJ, Bardell TK, Yates ML, Placzek EA, Barker EL
Molecular pharmacology 2008 Jul;74(1):101-8
Molecular pharmacology 2008 Jul;74(1):101-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- FAAH monoclonal antibody (M07), clone 4H8. Western Blot analysis of FAAH expression in NIH/3T3(Cat # L018V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- FAAH monoclonal antibody (M07), clone 4H8. Western Blot analysis of FAAH expression in rat brain.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged FAAH is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
