Antibody data

Product number
H00002166-M07
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002166-M07, RRID:AB_565720
Product name
FAAH monoclonal antibody (M07), clone 4H8
Provider product page
Abnova Corporation - H00002166-M07
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant FAAH.
Antigen sequence
DLNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTA
EDEAQMEHYRGYFGDIWDKMLQKGMKKSVGLPVAV
QCVALPWQEELCLRFMREVERLMTPEKQSS
Isotype
IgG
Antibody clone number
4H8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -