H00196441-B01P

ZFC3H1 antibody from Abnova Corporation
CCDC131, CSRC2, KIAA0546, MGC23401, PSRC2

Antibody data

Product number
H00196441-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00196441-B01P, RRID:AB_1572199
Product name
CCDC131 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00196441-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CCDC131 protein.
Antigen sequence
MATADTPAPASSGLSPKEEGELEDGEISDDDNNSQ
IRSRSSSSSSGGGLLPYPRRRPPHSARGGGSGGGG
GSSSSSSSSQQQLRNFSRSRHASERGHLRGPSSYR
PKEPFRSHPPSVRMPSSSLSESSPRPSFWERSHLA
LDRFRFRGRPYRGGSRWSRGRGVGERGGKPGCRPP
LGGGAGSGFSSSQSWREPSPPRKSSKSFGRSPSRK
QNYSSKNENCVEETFEDLLLKYKQIQLELECINKD
EKLALSSKEENVQEDPKTLNFEDQTSTDNVSITKD
SSKEVAPEEKTQVKTFQAFELKPLRQKLTLPGDKN
RLKKVKDGAKPLSLKSDTTDSSQGIPYRVKEGFTP
IPGLKFSA
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -