HPA002927

ENTPD5 antibody from Sigma-Aldrich
CD39L4, NTPDase-5, PCPH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002927
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002927, RRID:AB_1078744
Product name
Anti-ENTPD5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002927
Antibody type
Polyclonal
Antigen
Ectonucleoside triphosphate diphosphohydrolase 5 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AGSTGTRIHVYTFVQKMPGQLPILEGEVFDSVKPG
LSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTP
VVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLV
PKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQET
VGTL
Storage
-20C
Provider Type Product Number
- No reagents -