HPA004931

HTR1E antibody from Atlas Antibodies
5-HT1E
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004931
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004931, RRID:AB_1856706
Product name
Anti-HTR1E
Provider product page
Atlas Antibodies - HPA004931
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKL
TQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLD
HPGERQQISSTRER
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -