Antibody data
- Product number
- HPA004931
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA004931, RRID:AB_1856706
- Product name
- Anti-HTR1E
- Provider product page
- Atlas Antibodies - HPA004931
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKL
TQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLD
HPGERQQISSTRER
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image

- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and HTR1E over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY424479).
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human testis shows moderate membranous positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human endometrium shows moderate membranous positivity in glandular cells.
- Sample type
- HUMAN