HPA004931

HTR1E antibody from Sigma-Aldrich
5-HT1E
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004931
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004931, RRID:AB_1856706
Product name
Anti-HTR1E antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004931
Antibody type
Polyclonal
Antigen
5-hydroxytryptamine receptor 1E recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKL
TQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLD
HPGERQQISSTRER
Storage
-20C
Provider Type Product Number
- No reagents -