Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007356-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007356-M01, RRID:AB_425735
- Product name
- SCGB1A1 monoclonal antibody (M01), clone 4A5-A11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant SCGB1A1.
- Antigen sequence
MKLAVTLTLVTLALCCSSASAEICPSFQRVIETLL
MDTPSSYEAAMELFSPDQDMREAGAQLKKLVDTLP
QKPRESIIKLMEKIAQSSLCN- Isotype
- IgG
- Antibody clone number
- 4A5-A11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Lung progenitors from lambs can differentiate into specialized alveolar or bronchiolar epithelial cells.
Archer F, Abi-Rizk A, Desloire S, Dolmazon C, Gineys B, Guiguen F, Cottin V, Mornex JF, Leroux C
BMC veterinary research 2013 Nov 8;9:224
BMC veterinary research 2013 Nov 8;9:224
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SCGB1A1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol