HPA019010

AHNAK antibody from MilliporeSigma / Merck KGaA
MGC5395
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019010
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA019010, RRID:AB_1844657
Product name
Anti-AHNAK antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA019010
Antibody type
Polyclonal
Antigen
Neuroblast differentiation-associated protein AHNAK recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LGEGHLSVKGSGGEWKGPQVSSALNLDTSKFAGGL
HFSGPKVEGGVKGGQIGLQAPGLSVSGPQGHLESG
SGKVTFPKMKIPKFTFSGRELVGREMGVDVHFPKA
EASIQAGAGDGEWEESEVKLKKSKIKMPK
Storage
-20C
Provider Type Product Number
- No reagents -