HPA019010

AHNAK antibody from Atlas Antibodies
MGC5395
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019010
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019010, RRID:AB_1844657
Product name
Anti-AHNAK
Provider product page
Atlas Antibodies - HPA019010
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LGEGHLSVKGSGGEWKGPQVSSALNLDTSKFAGGL
HFSGPKVEGGVKGGQIGLQAPGLSVSGPQGHLESG
SGKVTFPKMKIPKFTFSGRELVGREMGVDVHFPKA
EASIQAGAGDGEWEESEVKLKKSKIKMPK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -