HPA005555

HTR1F antibody from Sigma-Aldrich
5-HT1F, HTR1EL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005555
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005555, RRID:AB_1856708
Product name
Anti-HTR1F antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005555
Antibody type
Polyclonal
Antigen
5-hydroxytryptamine receptor 1F recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVS
TSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKS
Storage
-20C
Provider Type Product Number
- No reagents -