Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405577 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Alcohol Dehydrogenase 4 (Class II), pi Polypeptide (ADH4) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ADH4 antibody: synthetic peptide directed towards the middle region of human ADH4
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
PLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKP
VYHFF GTSTFSQYTV- Vial size
- 50 µg
Submitted references Association of ADH and ALDH genes with alcohol dependence in the Irish Affected Sib Pair Study of alcohol dependence (IASPSAD) sample.
The CyberKnife stereotactic radiosurgery system: description, installation, and an initial evaluation of use and functionality.
Kuo PH, Kalsi G, Prescott CA, Hodgkinson CA, Goldman D, van den Oord EJ, Alexander J, Jiang C, Sullivan PF, Patterson DG, Walsh D, Kendler KS, Riley BP
Alcoholism, clinical and experimental research 2008 May;32(5):785-95
Alcoholism, clinical and experimental research 2008 May;32(5):785-95
The CyberKnife stereotactic radiosurgery system: description, installation, and an initial evaluation of use and functionality.
Kuo JS, Yu C, Petrovich Z, Apuzzo ML
Neurosurgery 2008 Feb;62 Suppl 2:785-9
Neurosurgery 2008 Feb;62 Suppl 2:785-9
No comments: Submit comment
No validations: Submit validation data